Protein coding transcript 131315

• Transcript: Ll_transcript_95802
• CDS coordinates: 25-627 (+)
• Peptide sequence: MVAVFNKEILSWYLITLKLKETLELGIPSSPNSGIQFTEFPEKQLQKLHQEPSLKITINENGEILQDEGTSTESEWAISIKEKLEQARGDDMTSSWDKLSIFKIPHYLRDSSSDDKAFVPQVVSLGPYHHGKRFLHQMDHHKWRSLTHVLKRTNHHLGLYLDSMKEIEEKARSCYEGTISLNCNEFVEMLVLDGCFVLELF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_95802

• Blastp: UPF0481 protein At3g47200 from Arabidopsis with 32.69% of identity
• Blastx: UPF0481 protein At3g47200 from Arabidopsis with 32.69% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G47200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421152.1)
• Pfam: Plant protein of unknown function (PF03140.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;