Transcript | Ll_transcript_49115 |
---|---|
CDS coordinates | 3-317 (-) |
Peptide sequence | LATKFLLKTDSAPNAVQSRAYIDGVMDNIQNGENIECPICFESPDDPVFTPCAYSLCKECLFNFWGTSAGGKCPICRQKLQKSDLITCPSLSPFKVDVENNMTES |
ORF Type | internal |
Blastp | DNA repair protein RAD5B from Arabidopsis with 48.62% of identity |
---|---|
Blastx | DNA repair protein RAD5B from Arabidopsis with 48.62% of identity |
Eggnog | Transcription termination factor, RNA polymerase II(ENOG410XPDU) |
Kegg | Link to kegg annotations (AT5G43530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449940.1) |
Pfam | Zinc finger, C3HC4 type (RING finger) (PF13920.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer