Protein coding transcript 131319

• Transcript: Ll_transcript_49115
• CDS coordinates: 3-317 (-)
• Peptide sequence: LATKFLLKTDSAPNAVQSRAYIDGVMDNIQNGENIECPICFESPDDPVFTPCAYSLCKECLFNFWGTSAGGKCPICRQKLQKSDLITCPSLSPFKVDVENNMTES
• ORF Type: internal

Annotations of Ll_transcript_49115

• Blastp: DNA repair protein RAD5B from Arabidopsis with 48.62% of identity
• Blastx: DNA repair protein RAD5B from Arabidopsis with 48.62% of identity
• Eggnog: Transcription termination factor, RNA polymerase II(ENOG410XPDU)
• Kegg: Link to kegg annotations (AT5G43530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449940.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;