| Transcript | Ll_transcript_199900 |
|---|---|
| CDS coordinates | 2-388 (+) |
| Peptide sequence | KLLAQREPLKFDDSWKRNPTDDVYVAKYYKWVVYPFAEAVKCHQETHSPEMYNKPNANLHVTIELNMQGEKKTRFVDNFTSVVKVPYNFDHGEERTIVVFSKNPDEQNEAITAGATLSGGSDLIKQIQN |
| ORF Type | internal |
| Blastp | 39S ribosomal protein L1, mitochondrial from Mus with 31.86% of identity |
|---|---|
| Blastx | - |
| Eggnog | Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release (By similarity)(COG0081) |
| Kegg | Link to kegg annotations (94061) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | - |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer