Protein coding transcript 131325

• Transcript: Ll_transcript_199893
• CDS coordinates: 3-311 (+)
• Peptide sequence: RHEGVFGLYRGLVPQLMGVAPEKAIKLTVNDFVRDKFYDKNGNIALYGEIISGACAGGSQVIFTNPLEIVKIRLQVAGEIAGGEKVRAWPVVKELGLLGLYKG
• ORF Type: internal

Annotations of Ll_transcript_199893

• Blastp: Calcium-binding mitochondrial carrier protein Aralar1 from Sophophora with 77.67% of identity
• Blastx: Calcium-binding mitochondrial carrier protein Aralar1 from Sophophora with 77.67% of identity
• Eggnog: solute carrier family 25 (aspartate glutamate carrier), member(ENOG410XNRM)
• Kegg: Link to kegg annotations (Dmel_CG2139)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004506741.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;