Protein coding transcript 131326

• Transcript: Ll_transcript_199898
• CDS coordinates: 3-317 (+)
• Peptide sequence: PGFANTLREAIPKIHQSEGLNGFYKSLVPLWMRQIPYTMMKFACFEKTIELLYKYVVPKPRAECTKGEQLIVTFGAGYIAGVFCAIVSHPADTLVSKLNQAKGAS
• ORF Type: internal

Annotations of Ll_transcript_199898

• Blastp: Phosphate carrier protein, mitochondrial from Mus with 76.19% of identity
• Blastx: Phosphate carrier protein, mitochondrial from Mus with 76.19% of identity
• Eggnog: Phosphate carrier protein(ENOG410XPST)
• Kegg: Link to kegg annotations (18674)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429663.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;