Protein coding transcript 131327

• Transcript: Ll_transcript_199899
• CDS coordinates: 2-379 (+)
• Peptide sequence: VFLSCGITHTMVTPLDLVKCRLQVDQAKYKNVVHGFKITMKEDGFKGLAKGWAPTFLGYAAQGMCKFGLYEVFKVHYSEMIGEENSYVYRTALYLAASASAEFFADVALSPMEAAKVRIQTQPGFA
• ORF Type: internal

Annotations of Ll_transcript_199899

• Blastp: Phosphate carrier protein, mitochondrial from Mus with 73.39% of identity
• Blastx: Phosphate carrier protein, mitochondrial from Mus with 73.39% of identity
• Eggnog: Phosphate carrier protein(ENOG410XPST)
• Kegg: Link to kegg annotations (18674)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003532391.2)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;