Protein coding transcript 131336

• Transcript: Ll_transcript_165643
• CDS coordinates: 235-642 (+)
• Peptide sequence: MSDEETPNTQPSTSETTNEAGSSATGVPDDDHQRQSTSVANPNSGALEVAEDKTAATDEYIRLRVITSDMTNEVHFRVKAATALVRLKRSYCSKLGFQVDELRFVFDGHRITDEDTPKSLGMINDDVIEIYQERTG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_165643

• Blastp: Small ubiquitin-related modifier from Caenorhabditis with 53.33% of identity
• Blastx: Small ubiquitin-related modifier from Caenorhabditis with 53.33% of identity
• Eggnog: smt3 suppressor of mif two 3 homolog(COG5227)
• Kegg: Link to kegg annotations (CELE_K12C11.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020202599.1)
• Pfam: Ubiquitin-2 like Rad60 SUMO-like (PF11976.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;