Protein coding transcript 131338

• Transcript: Ll_transcript_47304
• CDS coordinates: 3-371 (+)
• Peptide sequence: REVGVGDFVLMDKIDLDSFMQNLEHRFKNGFIYTYIGEVCVSVNPYRTMNIYDKAHINKYKDRELFENVPHIFAVADASHKVMKQQGRDTCIVISGESGSGKTEASKIIMKYIAAVTNQGGQQ
• ORF Type: internal

Annotations of Ll_transcript_47304

• Blastp: Myosin-IA from Sophophora with 69.67% of identity
• Blastx: Myosin-IA from Sophophora with 69.67% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (Dmel_CG7438)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020224383.1)
• Pfam: Myosin head (motor domain) (PF00063.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;