Protein coding transcript 131340

• Transcript: Ll_transcript_48357
• CDS coordinates: 42-431 (+)
• Peptide sequence: MPEYTLAEVQKHNDNKSTWIVIHNNVYDVTNFLNEHPGGEEVLLEQAGKDGSEAFEDVGHSNDAREMMVKYKIGEIVESERRPVKDRPVDWTASKNDDSSQSSFKTWIVPVSLGILATLLYRFIFQAQP*
• ORF Type: complete

Annotations of Ll_transcript_48357

• Blastp: Cytochrome b5 from Sophophora with 63.93% of identity
• Blastx: Cytochrome b5 from Sophophora with 63.93% of identity
• Eggnog: cytochrome b5(COG5274)
• Kegg: Link to kegg annotations (Dmel_CG2140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014518339.1)
• Pfam: Cytochrome b5-like Heme/Steroid binding domain (PF00173.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;