Transcript | Ll_transcript_48388 |
---|---|
CDS coordinates | 1-489 (+) |
Peptide sequence | RYMPGGIASGFNHAEINAGGEKKLYQVKGKKNIRVKQIEPKVTSMNQGDCFILDTGKEIFVYVGPQAKGTERLKAINVANQVRDQDHSGRAKVNIVDGSSTPDEFEKFFKELGSGSAKQVPAAIDDDQEFEKKETAAPVLYKISDSQGGKIVSEKIDQKPLVQ |
ORF Type | internal |
Blastp | Gelsolin from Sophophora with 56.97% of identity |
---|---|
Blastx | Gelsolin from Sophophora with 56.97% of identity |
Eggnog | capping protein (actin filament) gelsolin-like(ENOG410XR0A) |
Kegg | Link to kegg annotations (Dmel_CG1106) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020999459.1) |
Pfam | Gelsolin repeat (PF00626.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer