Protein coding transcript 131343

• Transcript: Ll_transcript_48393
• CDS coordinates: 3-743 (+)
• Peptide sequence: NTAHNLYIQNKHNHHNLPIIPSIFSHLLFLNAIPLNNEFLWFSLALVPIKIMGFKSLFNRKKKLLKKSTSSPTNLATPIISCATSVSVHSHAEFVEELEQVFKKFDVNGDGKISSSELGSIMGSLGQPSTEEELENMIHEVDADGDGYISLEEFIELNTKGVDSDEVLENLKDAFSVFDVDGNGSITAEELHMVMAGLGEECSPAECQKMISGVDSDGDGMINFEEFKTMMTGSRFQLKEIANVET*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_48393

• Blastp: Probable calcium-binding protein CML25 from Arabidopsis with 72.54% of identity
• Blastx: Probable calcium-binding protein CML25 from Arabidopsis with 72.54% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT1G24620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434968.1)
• Pfam: Secreted protein acidic and rich in cysteine Ca binding region (PF10591.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;