Protein coding transcript 131345

• Transcript: Ll_transcript_48374
• CDS coordinates: 3-410 (+)
• Peptide sequence: LVQRVTPPKTKKAGLLNMNSNDSNNVECCERKCLHCGAEKTPQWRSGPMGPKTLCNACGVRFKSGRLVPEYRPATSPTFVSTKHSNSHRKVMELRRQKEVQLHHHQHQQLIGQTSIFDVSSSGDDYLIHHHHHHY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_48374

• Blastp: GATA transcription factor 12 from Arabidopsis with 68.64% of identity
• Blastx: GATA transcription factor 12 from Arabidopsis with 68.7% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT5G25830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430298.1)
• Pfam: GATA zinc finger (PF00320.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;