Transcript | Ll_transcript_48374 |
---|---|
CDS coordinates | 3-410 (+) |
Peptide sequence | LVQRVTPPKTKKAGLLNMNSNDSNNVECCERKCLHCGAEKTPQWRSGPMGPKTLCNACGVRFKSGRLVPEYRPATSPTFVSTKHSNSHRKVMELRRQKEVQLHHHQHQQLIGQTSIFDVSSSGDDYLIHHHHHHY* |
ORF Type | 5prime_partial |
Blastp | GATA transcription factor 12 from Arabidopsis with 68.64% of identity |
---|---|
Blastx | GATA transcription factor 12 from Arabidopsis with 68.7% of identity |
Eggnog | Transcription factor(COG5641) |
Kegg | Link to kegg annotations (AT5G25830) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430298.1) |
Pfam | GATA zinc finger (PF00320.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer