Transcript | Ll_transcript_77287 |
---|---|
CDS coordinates | 1-309 (+) |
Peptide sequence | KYILYGSANVVTGETKSLFSLAKSWWQVDKVSPIKLFDENKTLAGLNMRHLMYQQGGAAHIQSIIEKVFALWSKGQIKPVIDSTWALEDVPEAMQKMHDRKNV |
ORF Type | internal |
Blastp | Synaptic vesicle membrane protein VAT-1 homolog-like from Homo with 59.8% of identity |
---|---|
Blastx | Synaptic vesicle membrane protein VAT-1 homolog-like from Homo with 59.8% of identity |
Eggnog | alcohol dehydrogenase(COG0604) |
Kegg | Link to kegg annotations (57687) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015932647.1) |
Pfam | Zinc-binding dehydrogenase (PF13602.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer