Protein coding transcript 131350

• Transcript: Ll_transcript_4650
• CDS coordinates: 2-472 (+)
• Peptide sequence: KLFDVIHRVLKNNMVNGTLDIGTTISSQLELLDLQHNSIDEFNPVINITNVTIILVDNPICRVDGVGKSYCSVPGQQQPNDDSYKPPSSPNNCAFVTCNSDQILSPNCQCGYPYSGTIIFRAPSFSGLGNKSDVETYLNQSFQSYGLPVSSFILYDP
• ORF Type: internal

Annotations of Ll_transcript_4650

• Blastp: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 33.11% of identity
• Blastx: Probable leucine-rich repeat receptor-like protein kinase At5g49770 from Arabidopsis with 32.45% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G49770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004486417.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;