Transcript | Ll_transcript_61889 |
---|---|
CDS coordinates | 2-604 (+) |
Peptide sequence | FFSYIGWHLCKKHPEVKNKGKGLDISDLYADPILFAQDKYYLIVMPLCCFILPVMIPMYFWNETFINSFSLNMLRYIITLNATWLVNSAAHLYGHKPYDKYINPAENKMVSIFALGEGWHNYHHTFPWDYKTYELGKYSTNFSAAFIDFFAKIGWAYDLKTVSPEMIKKRVQRTGDGSHEIWGWGDKDQSKEDYRDATIMY |
ORF Type | internal |
Blastp | Acyl-CoA Delta(11) desaturase from Spodoptera with 56.85% of identity |
---|---|
Blastx | Acyl-CoA Delta(11) desaturase from Spodoptera with 56.85% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004506950.1) |
Pfam | Fatty acid desaturase (PF00487.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer