Protein coding transcript 131357

• Transcript: Ll_transcript_61899
• CDS coordinates: 3-326 (+)
• Peptide sequence: DLKKNLKGGDSKNPTETNELSQPIEEDEDDPKEKGKLKPNAGNGCDLPNYRWTQTLSDIELKIPSKAAFKLRPRDVIVNLKKKHIFVGIKGQPPILDDELQHEIKLEE
• ORF Type: internal

Annotations of Ll_transcript_61899

• Blastp: Nuclear migration protein nudC from Gallus with 55.17% of identity
• Blastx: Nuclear migration protein nudC from Mus with 53.62% of identity
• Eggnog: nudC domain containing(ENOG410XQVU)
• Kegg: Link to kegg annotations (419578)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004498517.1)
• Pfam: CS domain (PF04969.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;