Transcript | Ll_transcript_169643 |
---|---|
CDS coordinates | 3-422 (+) |
Peptide sequence | LGKLYKKIGNHKKSKEWRNHASLWNKNIDTVLYDEKDGIWYDYDNVKGVLKKGFYPSNFAPLFSMSYDFERSEILGDRAAEYFERMNVTKYSGGIPTSLILSGEQWDLPNAWPPTQDMVVTGLHKTKSKKAQSLAELLAT |
ORF Type | internal |
Blastp | Trehalase from Tenebrio with 47.48% of identity |
---|---|
Blastx | Trehalase from Tenebrio with 47.48% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017410720.1) |
Pfam | Trehalase (PF01204.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer