Protein coding transcript 131364

• Transcript: Ll_transcript_12738
• CDS coordinates: 1-357 (+)
• Peptide sequence: KYLTYETRNNVQLLINKLFELPMKNEDGYMYVDLPEPRYNLPREKPLPTPKPLTKWQKFAIEKGIKKTPKPKATWDDILQKWIPTYGYKKAAADKEKDWILEVPGNAADPNIDLFAQKR
• ORF Type: internal

Annotations of Ll_transcript_12738

• Blastp: Ribosome biogenesis regulatory protein homolog from Caenorhabditis with 47.01% of identity
• Blastx: Ribosome biogenesis regulatory protein homolog from Caenorhabditis with 47.01% of identity
• Eggnog: ribosome biogenesis regulatory protein(COG5225)
• Kegg: Link to kegg annotations (CBG04617)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004485584.1)
• Pfam: Ribosome biogenesis regulatory protein (RRS1) (PF04939.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;