Protein coding transcript 131366

• Transcript: Ll_transcript_77301
• CDS coordinates: 1-324 (+)
• Peptide sequence: VFWTSKNIILGKSHYLLYTLAAAMQPRMLVTFDEECNPLAVPVRVGLAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATDEYIPLSPIMEGFVILRKNPDFEP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_77301

• Blastp: 26S proteasome non-ATPase regulatory subunit 2 from Mus with 80% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 2 from Mus with 80% of identity
• Eggnog: 26s proteasome regulatory subunit(COG5110)
• Kegg: Link to kegg annotations (21762)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004505542.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;