Protein coding transcript 131368

• Transcript: Ll_transcript_270937
• CDS coordinates: 3-566 (+)
• Peptide sequence: QLEALNPTPAPTQALPLLNGKWILAYTSFRGLFPLLSQAIAPFIRAGDISQTIDSETYAVQNSVQFVGPWTTTDVNCHGKYEVRSPKRVQLKIEERVIGTPQLTDSLTIPEEVEFVGQKIDLKPLKGILDEKAKKLSRKPPVRLPVPKPFAESWLLTTYLDEDIRVSRGDFGSVFVFFKEGSSFFTS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_270937

• Blastp: Plastid-lipid-associated protein, chloroplastic from Citrus with 64.02% of identity
• Blastx: Plastid-lipid-associated protein, chloroplastic from Citrus with 63.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425196.1)
• Pfam: PAP_fibrillin (PF04755.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;