Protein coding transcript 131370

• Transcript: Ll_transcript_270959
• CDS coordinates: 2-616 (+)
• Peptide sequence: SLPIQDINNDYEMSQLKNDMEFQKLENFALHMENVDSRMLSPEEVISQFKEEFELDLKDESYEKILPILPLPNSARFIHDFSANVTGIVDIDGKRCFIMPLNRSAVLPPQSLYDLLFKMSSGYYAVDTSNVMHNMRVVKPAIQDLTEYGIYIAKDCAGFPTYKLEKIVSGVFKRSVSTHSKTFSAFSGQMDTFRLVNYQDIDLQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_270959

• Blastp: Integral membrane protein 2B from Sus with 32.76% of identity
• Blastx: Integral membrane protein 2B from Sus with 32.76% of identity
• Eggnog: integral membrane protein(ENOG410XRNN)
• Kegg: Link to kegg annotations (595120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014516478.1)
• Pfam: BRICHOS domain (PF04089.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;