Protein coding transcript 131372

• Transcript: Ll_transcript_270953
• CDS coordinates: 2-397 (+)
• Peptide sequence: RLVPDQDPEKIDKLVVKFLNEKWKKRGSPNRFKAYSLHGGRPWTSDPSHPHYQAAAKATEYVYKVKPDLTREGGSIPVTLTLQEVSGKNVLLLPVGMGDDSPHSQNEKLNVRNYIEGTKLLGAYLYECSKL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_270953

• Blastp: Cytosolic non-specific dipeptidase from Rattus with 63.36% of identity
• Blastx: Cytosolic non-specific dipeptidase from Rattus with 63.36% of identity
• Eggnog: succinyl-diaminopimelate desuccinylase activity(COG0624)
• Kegg: Link to kegg annotations (291394)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015971883.1)
• Pfam: Peptidase family M20/M25/M40 (PF01546.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;