| Transcript | Ll_transcript_270946 |
|---|---|
| CDS coordinates | 1-360 (+) |
| Peptide sequence | TKTLALVVEDIDAPDPDGPIVPWTHWVVVNIPPSAKKLPEGSSGKEEMGEEYAGMKEGNNDLKVPGWCAPKLPTHGHRIQFKLYALDFEVNLGNKVTKEKLLDSIEGHVLGEAILMAKY* |
| ORF Type | 5prime_partial |
| Blastp | UPF0098 protein MTH_273 from Methanothermobacter with 41.18% of identity |
|---|---|
| Blastx | UPF0098 protein MTH_273 from Methanothermobacter with 40.34% of identity |
| Eggnog | phosphatidylethanolamine-binding protein(COG1881) |
| Kegg | Link to kegg annotations (MTH_273) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463126.1) |
| Pfam | Phosphatidylethanolamine-binding protein (PF01161.19) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer