Protein coding transcript 131379

• Transcript: Ll_transcript_59180
• CDS coordinates: 1-441 (+)
• Peptide sequence: VKIPEGVKVSVRKRIVTVTGPRGVLKRAFKHLFITMYKTKEGTFRVEKWFGKKKELAAVRTVCSHIENMIKGVTKGFQYKMRAVYAHFPINCVTSENNTVLEIRNFLGEKFIRRVEMAKGVTVVNSTKQKDELILEGNSLEDVSQSA
• ORF Type: internal

Annotations of Ll_transcript_59180

• Blastp: 60S ribosomal protein L9 from Sophophora with 78.23% of identity
• Blastx: 60S ribosomal protein L9 from Sophophora with 78.23% of identity
• Eggnog: This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7 L12 stalk, and near the tRNA binding site of the peptidyltransferase center (By similarity)(COG0097)
• Kegg: Link to kegg annotations (Dmel_CG6141)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020209950.1)
• Pfam: Ribosomal protein L6 (PF00347.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;