Protein coding transcript 131381

• Transcript: Ll_transcript_59164
• CDS coordinates: 3-380 (+)
• Peptide sequence: SIYIYDAEAGQAIDMVEGEKVYVVEAHNTDWWFVKKHLTEEKGWVPAQVLMDEEKYIQYVQRKLNEKIDKLPVLEKPKPEEIDRTKAPKFVDKLKPISSPDGYTVTFQCKVEGFPRPQITWFKQTS
• ORF Type: internal

Annotations of Ll_transcript_59164

• Blastp: Titin from Sophophora with 62.7% of identity
• Blastx: Titin from Sophophora with 62.7% of identity
• Eggnog: IG_like(ENOG410XTJ8)
• Kegg: Link to kegg annotations (Dmel_CG1915)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017408795.1)
• Pfam: SH3 domain (PF00018.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;