Protein coding transcript 131383

• Transcript: Ll_transcript_59172
• CDS coordinates: 1-297 (+)
• Peptide sequence: LILVKSLPKIVQSTKSIVKNQKMGNRSSLLLRQEEIAQIQQETGFTASQIERLYSRFTALDRGDCGTLSRDDFLRIPELAINPLGERIVNSFFQGDEFT
• ORF Type: internal

Annotations of Ll_transcript_59172

• Blastp: Calcineurin B homologous protein 1 from Rattus with 70.42% of identity
• Blastx: Calcineurin B homologous protein 1 from Rattus with 70.42% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (64152)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014510645.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;