Protein coding transcript 131385

• Transcript: Ll_transcript_4032
• CDS coordinates: 3-440 (+)
• Peptide sequence: KCFIEEIPDETTVVSHYKVELFDVRTGGFTPPTPGIGMNVEVKDPDMKIILSRVYSFEGKISFTSHIPGEHIICLYSNTTAWIGGTQLRVHLDIQVGDQAIDYAQVAQKEKLSDLQLRIRQLVEQVEQIIKEQSYQRFREERFRQT
• ORF Type: internal

Annotations of Ll_transcript_4032

• Blastp: Transmembrane emp24 domain-containing protein eca from Sophophora with 75.34% of identity
• Blastx: Transmembrane emp24 domain-containing protein eca from Sophophora with 75.34% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Dper_GL12279)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014499734.1)
• Pfam: emp24/gp25L/p24 family/GOLD (PF01105.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;