Protein coding transcript 131388

• Transcript: Ll_transcript_4013
• CDS coordinates: 3-458 (+)
• Peptide sequence: GNFLSLSLLESQFHYQTSIEESVVVIYDTAKTARGFLTCKAYRLTPQAINMYKEGEFTPEALRTLKVGFESLFVEVPVVVKNSLLTNIMLTEIDEMVPEDEGTKFLDLGTAGVLENQLRSMMDRVDELNQEAIKFNRFQVQVIRQQQEKHRF
• ORF Type: internal

Annotations of Ll_transcript_4013

• Blastp: Eukaryotic translation initiation factor 3 subunit H from Bombyx with 78.29% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit H from Bombyx with 78.29% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(ENOG410XSR9)
• Kegg: Link to kegg annotations (692388)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443682.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;