| Transcript | Ll_transcript_28023 |
|---|---|
| CDS coordinates | 3-371 (+) |
| Peptide sequence | SGWSPLGAYKASWGSNAVMENPILKEIAHSRQKNVAQVALRWIYEQGASTVVKSFNKERMKVNLGIFDWELSEEESEKIRQIPQRRMYNGEEFVSPNGPYRSLEEFVSPNGPYRSLEEFVSPN |
| ORF Type | internal |
| Blastp | Non-functional NADPH-dependent codeinone reductase 2 from Papaver with 57.55% of identity |
|---|---|
| Blastx | Non-functional NADPH-dependent codeinone reductase 2 from Papaver with 57.55% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019436051.1) |
| Pfam | Aldo/keto reductase family (PF00248.20) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer