Protein coding transcript 131395

• Transcript: Ll_transcript_270912
• CDS coordinates: 1-516 (+)
• Peptide sequence: LNMSKRNKDLEAEVLTWIFAVIGEPIPKGEFEDILKDGVVLCNLMNKLTPGCIKKIQSKGTNFQLMENIQRFQAAAKAYGLPQEEIFQTADLFERRNISQVALSLFALGRITQKHSEWNGPTLGPKMAEKNERTFTEEQLRAHEGQLNLQMGFNKGASQSGHGGFGNTRHM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_270912

• Blastp: Myophilin from Echinococcus with 54.72% of identity
• Blastx: Myophilin from Echinococcus with 54.72% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020959671.1)
• Pfam: Calponin homology (CH) domain (PF00307.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;