Protein coding transcript 131398

• Transcript: Ll_transcript_270914
• CDS coordinates: 1-435 (+)
• Peptide sequence: DQHQMSKDQWEVRIIRWWTEHKGMPREDAMMEYLKIAQDLDMYGINYFEIRNKKGTDLWLGVDALGLNIYAKDNKLTPKIGFPWAEISNISFNDRKFIIKPIDKKAQDVVFFAPRVRINKRILALCMGNHELFMRRRKPDTIDVQ
• ORF Type: internal

Annotations of Ll_transcript_270914

• Blastp: Moesin/ezrin/radixin homolog 1 from Culex with 86.21% of identity
• Blastx: Moesin/ezrin/radixin homolog 1 from Culex with 86.21% of identity
• Eggnog: domain) containing(ENOG410XQFP)
• Kegg: Link to kegg annotations (CpipJ_CPIJ012259)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016165577.1)
• Pfam: FERM central domain (PF00373.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;