Protein coding transcript 1314

• Transcript: Ll_transcript_358617
• CDS coordinates: 43-513 (+)
• Peptide sequence: MQIFLTNLANETLVLDVDASETVENVKNQISIREGIPSSEQRLIFGSKQLEDGALLSDYGVQKESTIHLTCGLSGGAKKRKKKNYSTPKKIKHKKKKVKLAVLKYYKVDENGKISRLRRECESEVCGAGVFMAAMADRHYCGKCGFTLVFNKPEEK*
• ORF Type: complete

Annotations of Ll_transcript_358617

• Blastp: Ubiquitin-40S ribosomal protein S27a from Sophophora with 72.44% of identity
• Blastx: Ubiquitin-40S ribosomal protein S27a from Sophophora with 72.44% of identity
• Eggnog: ubiquitin(COG5272)
• Kegg: Link to kegg annotations (Dmel_CG5271)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020220667.1)
• Pfam: Ubiquitin-2 like Rad60 SUMO-like (PF11976.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;