| Transcript | Ll_transcript_216867 |
|---|---|
| CDS coordinates | 85-405 (-) |
| Peptide sequence | GEGVRVEVENDEGGYRRVSVVETARIAAEEHGGVRKWVDKRLKDSFPVEVAERMIRVGLECLEEDPIERPDMGRVAVEVSKLYLESQKWTEKMGNNIDLSLSLAPR* |
| ORF Type | 5prime_partial |
| Blastp | Chitin elicitor receptor kinase 1 from Arabidopsis with 29% of identity |
|---|---|
| Blastx | Chitin elicitor receptor kinase 1 from Arabidopsis with 29% of identity |
| Eggnog | Serine Threonine protein kinase(COG0515) |
| Kegg | Link to kegg annotations (AT3G21630) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433811.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer