Protein coding transcript 131404

• Transcript: Ll_transcript_97275
• CDS coordinates: 3-338 (+)
• Peptide sequence: YMDDDDDDDASTRPPRKMPDEFKPNVPNNVPKPPLRDLKSVITTATKKLNPKKAAAKVASANAKVPKSGLSKNAVRGEVDKIQKQILALQTVKEFVKSSYDSATARYWETEE
• ORF Type: internal

Annotations of Ll_transcript_97275

• Blastp: Protein NETWORKED 2D from Arabidopsis with 52.78% of identity
• Blastx: Protein NETWORKED 2D from Arabidopsis with 53.85% of identity
• Eggnog: Kinase interacting(ENOG410Y9Y9)
• Kegg: Link to kegg annotations (AT2G22560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420508.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;