Protein coding transcript 131408

• Transcript: Ll_transcript_244110
• CDS coordinates: 1-330 (+)
• Peptide sequence: KRFTFAEKLLPQLGYQKRAHLMNPMVPGLTGNKMSSSEEDSKIDLLDSPSNVKKKLKKAFCEPGNIENNGVLSFSKHVIFPLLKPEEKFVVPRKPENGGDSFFETFEKLQ
• ORF Type: internal

Annotations of Ll_transcript_244110

• Blastp: Tyrosine--tRNA ligase, cytoplasmic from Silurana with 71.82% of identity
• Blastx: Tyrosine--tRNA ligase, cytoplasmic from Silurana with 71.82% of identity
• Eggnog: Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation (By similarity)(COG0073)
• Kegg: Link to kegg annotations (448444)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004513862.1)
• Pfam: tRNA synthetases class I (W and Y) (PF00579.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;