Protein coding transcript 131410

• Transcript: Ll_transcript_73869
• CDS coordinates: 14-619 (+)
• Peptide sequence: MGAALGLCSAAQLACCCGSAACSLCCSACPSCRNSTSSRIMYALMLLVTTVAACITLSPGLQDVLKKVPFCKNGSGSSLASGLVLDCEKAVGYLAVYRICFILTCFFVLMSMIMIGVKSSRDPRSGIQNGFWGLKYLLVVGGVVGSFFIPEGTFGSVWMYFGMIGGFMFIIIQLILIVDFAHSWAEAWVGNYEETESKGWYY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_73869

• Blastp: Probable serine incorporator from Nematostella with 56.1% of identity
• Blastx: Probable serine incorporator from Nematostella with 53.49% of identity
• Eggnog: serine incorporator(ENOG410XP7K)
• Kegg: Link to kegg annotations (NEMVE_v1g242820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461349.1)
• Pfam: Serine incorporator (Serinc) (PF03348.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;