Transcript | Ll_transcript_73873 |
---|---|
CDS coordinates | 3-314 (+) |
Peptide sequence | WLWLGAQLSTLHFAERRRVLNQRLKMYTFVGCLVAALACSSIAQAAGSVPVTVYYESLCPDSIKFYINQLYPAMENPNLSTYVDLTLVPYGKSSHEKLENGSWA |
ORF Type | internal |
Blastp | GILT-like protein 1 from Sophophora with 47.69% of identity |
---|---|
Blastx | GILT-like protein 1 from Sophophora with 55.32% of identity |
Eggnog | Lysosomal thiol(ENOG4111IDT) |
Kegg | Link to kegg annotations (Dmel_CG9796) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014489645.1) |
Pfam | Gamma interferon inducible lysosomal thiol reductase (GILT) (PF03227.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer