Protein coding transcript 131413

• Transcript: Ll_transcript_73873
• CDS coordinates: 3-314 (+)
• Peptide sequence: WLWLGAQLSTLHFAERRRVLNQRLKMYTFVGCLVAALACSSIAQAAGSVPVTVYYESLCPDSIKFYINQLYPAMENPNLSTYVDLTLVPYGKSSHEKLENGSWA
• ORF Type: internal

Annotations of Ll_transcript_73873

• Blastp: GILT-like protein 1 from Sophophora with 47.69% of identity
• Blastx: GILT-like protein 1 from Sophophora with 55.32% of identity
• Eggnog: Lysosomal thiol(ENOG4111IDT)
• Kegg: Link to kegg annotations (Dmel_CG9796)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014489645.1)
• Pfam: Gamma interferon inducible lysosomal thiol reductase (GILT) (PF03227.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;