Protein coding transcript 131415

• Transcript: Ll_transcript_73875
• CDS coordinates: 1-597 (+)
• Peptide sequence: KLQCCPTSDGSAAAILASESFVRSHGLESQAIEIIGMEMATDTSSSFADSHMKLVGYDMTKRAADQLFRKANKNPSDVQVVELHDCFSANELITYEALGLCQPGGAGALIDSGDNTYGGKYVINPSGGLISKGHPLGATGLAQCAELTWQLRGQADKRQVPGAKLALQHNIGLGGAVVVALYQHGFPQYQNKQLAMRKT
• ORF Type: internal

Annotations of Ll_transcript_73875

• Blastp: Non-specific lipid-transfer protein from Oryctolagus with 71.81% of identity
• Blastx: Non-specific lipid-transfer protein from Oryctolagus with 71.81% of identity
• Eggnog: sterol carrier protein(ENOG410XPRW)
• Kegg: Link to kegg annotations (100008683)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015949962.2)
• Pfam: Thiolase, C-terminal domain (PF02803.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;