Transcript | Ll_transcript_73887 |
---|---|
CDS coordinates | 2-316 (+) |
Peptide sequence | VTYVPYSMGRMEYNWGPDAASFIPERWFKDGILQNESPFKFTAFQAGPRICLGKDSAYLQMRMVLAILCRFYKFKLIPGHPVKYRMMTILSMKHGLKLTTEKRS* |
ORF Type | 5prime_partial |
Blastp | Cytochrome P450 704B1 from Arabidopsis with 82.69% of identity |
---|---|
Blastx | Cytochrome P450 704B1 from Arabidopsis with 82.69% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (AT1G69500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459626.1) |
Pfam | Cytochrome P450 (PF00067.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer