Transcript | Ll_transcript_183111 |
---|---|
CDS coordinates | 1-342 (+) |
Peptide sequence | KWDAIEKLPTYDRLRKGLLKQVLDDGKVYYQEVDITKLGVQEKKHLLETVLRTAEEDNEKFLHKIRDRIDRAEIEIPKIEVRFEDLSVEGDAYIGTRALPTLLNATLNTVEGVL |
ORF Type | internal |
Blastp | Pleiotropic drug resistance protein 2 from Nicotiana with 64.91% of identity |
---|---|
Blastx | Pleiotropic drug resistance protein 2 from Nicotiana with 64.91% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462123.1) |
Pfam | ABC-transporter extracellular N-terminal (PF14510.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer