| Transcript | Ll_transcript_183111 |
|---|---|
| CDS coordinates | 1-342 (+) |
| Peptide sequence | KWDAIEKLPTYDRLRKGLLKQVLDDGKVYYQEVDITKLGVQEKKHLLETVLRTAEEDNEKFLHKIRDRIDRAEIEIPKIEVRFEDLSVEGDAYIGTRALPTLLNATLNTVEGVL |
| ORF Type | internal |
| Blastp | Pleiotropic drug resistance protein 2 from Nicotiana with 64.91% of identity |
|---|---|
| Blastx | Pleiotropic drug resistance protein 2 from Nicotiana with 64.91% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462123.1) |
| Pfam | ABC-transporter extracellular N-terminal (PF14510.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer