Protein coding transcript 131420

• Transcript: Ll_transcript_183116
• CDS coordinates: 3-710 (+)
• Peptide sequence: QTIFVVVIAMVYVQAEKSKVIPPYIKQCIRNDPKLNECLAAEINHLRPYLKEGIDEIELPPVEPFRMDSLSLAITGGSNGYKITLRDIDLFGASNFSIQKVLLRPNAPFEGKVRIPKMTMDAKYASTGVLLVLPANGNGSFHADLGDVTATVKGIVSSYYKDTEKYYNLDFLEVDLVIKKAYMVVSKVNNNRIIVEATNLFLRENGQEVLQVMMPQLRSKLAAIFKTIVNQLLTHV
• ORF Type: internal

Annotations of Ll_transcript_183116

• Blastp: Circadian clock-controlled protein from Sophophora with 23.27% of identity
• Blastx: Circadian clock-controlled protein from Sophophora with 23.27% of identity
• Eggnog: circadian rhythm(ENOG4110N42)
• Kegg: Link to kegg annotations (Dmel_CG2650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_012567754.1)
• Pfam: Haemolymph juvenile hormone binding protein (JHBP) (PF06585.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;