Transcript | Ll_transcript_183100 |
---|---|
CDS coordinates | 2-289 (-) |
Peptide sequence | MYSFALPSFKEQLEELDSETNPIVLVNTFEELEHEALRAIEDIRMIPIGPLIPSAFLDGKDPNDTSFGGDIIHGTNDYVTTWLDSKPKLSVVYVSF |
ORF Type | 3prime_partial |
Blastp | Crocetin glucosyltransferase, chloroplastic from Gardenia with 63.54% of identity |
---|---|
Blastx | Crocetin glucosyltransferase, chloroplastic from Gardenia with 62.86% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (BAK55736) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415874.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer