Protein coding transcript 131427

• Transcript: Ll_transcript_216555
• CDS coordinates: 3-311 (+)
• Peptide sequence: CAVVTKMISIRKAVFIVNTFLLCVLLVFNIYFTNGDMTIVDIKEFEYGGDIFFEITHPPELQYTYRIRPAKSFGIPFDKEKFPAKKTKLVLVDPHHGCEMPKN
• ORF Type: internal

Annotations of Ll_transcript_216555

• Blastp: PRADC1-like protein from Sophophora with 46.43% of identity
• Blastx: PRADC1-like protein from Sophophora with 46.43% of identity
• Eggnog: Protease-associated domain containing 1(ENOG41101GD)
• Kegg: Link to kegg annotations (Dmel_CG9849)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020985876.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;