Protein coding transcript 131429

• Transcript: Ll_transcript_216567
• CDS coordinates: 3-347 (+)
• Peptide sequence: GTEIADDDIQHIVQMCDEILDISTYRTSLSDYLKSRMMAVAPNVTVLLGDLVGARMLAQGGSLVNVAKMPASTIQLCGAEKALFRALKKKHDTPKYGLIYHSSLVGRATAKVKGR
• ORF Type: internal

Annotations of Ll_transcript_216567

• Blastp: Nucleolar protein 58 from Cryptococcus neoformans species complex with 64.35% of identity
• Blastx: Nucleolar protein 58 from Cryptococcus neoformans species complex with 64.35% of identity
• Eggnog: Nucleolar protein(COG1498)
• Kegg: Link to kegg annotations (CNF00090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014494380.1)
• Pfam: snoRNA binding domain, fibrillarin (PF01798.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;