Transcript | Ll_transcript_216561 |
---|---|
CDS coordinates | 386-736 (+) |
Peptide sequence | MAAALAAASIVFNDDRVYSKNLVHAATTLFKFSRDHIGQYDSGSEDARFYNSSGYFDEFVWGGAWMYYATGNSTYLNFVTTPSVAQDAGNLVRGPNYGVLSWDNKLAGAQNVSKETI |
ORF Type | 3prime_partial |
Blastp | Endoglucanase 9 from Oryza sativa with 61.76% of identity |
---|---|
Blastx | Endoglucanase 9 from Oryza sativa with 65.52% of identity |
Eggnog | endoglucanase(ENOG410XP0H) |
Kegg | Link to kegg annotations (4332724) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442456.1) |
Pfam | Glycosyl hydrolase family 9 (PF00759.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer