Protein coding transcript 131431

• Transcript: Ll_transcript_209906
• CDS coordinates: 3-344 (+)
• Peptide sequence: FDEISQDTGKYCFGVEDTLKALELGSVETLICWENLDIQRYVLKNHTTAEEKILHLTPEQEKDKSHFTEKDTGVELELVECQPLLEWLANNYKIFGATLEIITDKSQEGSQFVR
• ORF Type: internal

Annotations of Ll_transcript_209906

• Blastp: Eukaryotic peptide chain release factor subunit 1 from Sophophora with 86.09% of identity
• Blastx: Eukaryotic peptide chain release factor subunit 1 from Sophophora with 86.09% of identity
• Eggnog: Peptide Chain Release Factor(COG1503)
• Kegg: Link to kegg annotations (Dmel_CG5605)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003548046.1)
• Pfam: eRF1 domain 3 (PF03465.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;