Transcript | Ll_transcript_40127 |
---|---|
CDS coordinates | 3-389 (+) |
Peptide sequence | KINFARVFPKPFASSRAMVGTYIVCTGVGWYLYLLNDQLVDKYQVESRSSLIAITPLLDAEADREYLKQLRKNRETEEKLMKNVKGWKTGTLYGEPVYKTVDKNELIEPGLNEYYVHAPDKVLYDRVYW |
ORF Type | internal |
Blastp | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 from Bos with 32.52% of identity |
---|---|
Blastx | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 from Bos with 32.52% of identity |
Eggnog | NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex(ENOG4111KIB) |
Kegg | Link to kegg annotations (338084) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020222596.1) |
Pfam | GRIM-19 protein (PF06212.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer