Protein coding transcript 131433

• Transcript: Ll_transcript_40127
• CDS coordinates: 3-389 (+)
• Peptide sequence: KINFARVFPKPFASSRAMVGTYIVCTGVGWYLYLLNDQLVDKYQVESRSSLIAITPLLDAEADREYLKQLRKNRETEEKLMKNVKGWKTGTLYGEPVYKTVDKNELIEPGLNEYYVHAPDKVLYDRVYW
• ORF Type: internal

Annotations of Ll_transcript_40127

• Blastp: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 from Bos with 32.52% of identity
• Blastx: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 from Bos with 32.52% of identity
• Eggnog: NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex(ENOG4111KIB)
• Kegg: Link to kegg annotations (338084)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020222596.1)
• Pfam: GRIM-19 protein (PF06212.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;