Protein coding transcript 131435

• Transcript: Ll_transcript_40125
• CDS coordinates: 2-472 (+)
• Peptide sequence: ISPISLSSSSNRRSFDQCRYFQTSAILWEEHVLKTPAFADSVSEGDMRWEKNVGDTVAVDEVVCEIETDKTSVPVPSPVNGIIAQRLVEDGATVKAGQDLCTITITEGGPAPAKAAPKVEATPKVEDTPKAAEPVPPVAVAAAAPVPATPPPQVSQP
• ORF Type: internal

Annotations of Ll_transcript_40125

• Blastp: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial from Homo with 62.92% of identity
• Blastx: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial from Homo with 63.95% of identity
• Eggnog: Dehydrogenase(COG0508)
• Kegg: Link to kegg annotations (1743)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020963680.1)
• Pfam: Biotin-requiring enzyme (PF00364.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;