Protein coding transcript 131436

• Transcript: Ll_transcript_194926
• CDS coordinates: 1-345 (+)
• Peptide sequence: PNNASKMNHQVATNVKEESHHVSRDKRGQVLGKGELQEFRGCTIWFTGLSGAGKTSIYFALEEFLVSNGIPSYGLDGDNLRTGLNKNLGFTKEDREENIRRVAEVAKLFADAGHV
• ORF Type: internal

Annotations of Ll_transcript_194926

• Blastp: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase from Urechis with 74.07% of identity
• Blastx: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase from Urechis with 74.07% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016202383.1)
• Pfam: Adenylylsulphate kinase (PF01583.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;