Protein coding transcript 131439

• Transcript: Ll_transcript_97406
• CDS coordinates: 181-558 (+)
• Peptide sequence: MGEVKVPRNGNCKTVAIRYRFVFENVGGGEPHLQFLPHPLLKLKVDPPKVENEEEQLKPEDVKYEDDVEYLRSLDPKEWKSQDHYKVLGIQKLRFKATDDIIKTAHRKKVLKHHPDKRKAQGEEIK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_97406

• Blastp: DnaJ homolog subfamily C member 2 from Silurana with 67.27% of identity
• Blastx: DnaJ homolog subfamily C member 2 from Silurana with 67.27% of identity
• Eggnog: Transcription factor(COG5269)
• Kegg: Link to kegg annotations (394933)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418454.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;